T1004_1_55 Domain 1 Parse 1 Confidence: 0.29
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
510 | Complete | Structure prediction | casp | T1004_1_55 | 55 | 16 Jul 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
736 | 1 | 1 | 0.29 | comparative modeling | 1-55 | 55 | 17 Jul 2018 |
>736
MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTD
>4lb5A_301 weight: 0.9551 score: 5.91 eval: n/a prob: n/a identity: 0.1636 startpos: 1
-------EIEMRICDYLRRhvQDIFKELkeKSTVNRHLYSLQAstVKRPVWNLV-
>2heoA_303 weight: 0.0449 score: 5.64 eval: n/a prob: n/a identity: 0.0545 startpos: 1
------DNLEQKILQVLSDdiFQLVKKcvPKKTLNQVLYRLKKesPSPKYWSIGG
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington