2021-10-23_00000091_1_19 Domain 4 Parse 1 Confidence: 0.06
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
142551 | Complete | Structure prediction | RoseTTAFold | 2021-10-23_00000091_1_19 | 1066 | 23 Oct 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
139155 | 4 | 1 | 0.06 | comparative modeling | 982-1066 | 85 | 24 Oct 2021 |
>139155
SGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNGGSLEVLFQGPSSPSAWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
>4g7xA_301 weight: 1.0000 score: 6.11 eval: n/a prob: n/a identity: 0.1529 startpos: 1
------INCDPNTTTSHQLlgSPIVQSVLFdlDIelSNENGDYCKGLYKPRFTQGvpNWPMCDLSGASAE----RCIYPYCPEGE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington