SSGCID - LpinA.00107.a Heavy metal efflux pump Domain 1 Parse 1 Confidence: 0.56
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
2677 | Complete | Structure prediction | ssgcid | SSGCID - LpinA.00107.a He... | 333 | 9 Apr 2019 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
2982 | 1 | 1 | 0.56 | comparative modeling | 1-44 | 44 | 14 Apr 2019 |
>2982
MKIHFTSRTLLITGAAIVIAIVSLAILGLSNRVDKKTKLPPSKP
>1m0fB_304 weight: 1.0000 score: 7.07 eval: n/a prob: n/a identity: 0.0909 startpos: 1
MEQLTkkRDEIEAGKSYCSRRfdKSAQIYARFDKNDWRIQPAEF
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington