2022-08-13_00000149_1_19 Domain 4 Parse 1 Confidence: 0.33
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
394258 | Complete | Structure prediction | RoseTTAFold | 2022-08-13_00000149_1_19 | 1099 | 13 Aug 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
390259 | 4 | 1 | 0.33 | comparative modeling | 666-722 | 57 | 14 Aug 2022 |
>390259
RIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQFLKSMLAMWGVNAQGWLTHKLGE
>6g4wr_201 weight: 1.0000 score: 25.47 eval: 18 prob: 78.9 identity: 0.1228 startpos: 36
--EFNPNFVARMIPKVEWSAFLEAADNLRleNEEFLRTMHHLLLEVEV---------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington