2022-11-19_00000158_1_19 Domain 2 Parse 1 Confidence: 0.31
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
450091 | Complete | Structure prediction | RoseTTAFold | 2022-11-19_00000158_1_19 | 2201 | 19 Nov 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
445513 | 2 | 1 | 0.31 | comparative modeling | 235-301 | 67 | 20 Nov 2022 |
>445513
TTLKISDKKEDKKVIENINKKDEKKVQGVNTVNPQDEVLAGKLTKPELLYSDKIIETPLKYNQIIES
>1m0fB_301 weight: 1.0000 score: 8.13 eval: n/a prob: n/a identity: 0.0896 startpos: 3
QLTKNQRKKRDEIEAGKSYCSRRFG--GATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGY
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington