2021-01-02_00000090_1_11 Domain 3 Parse 1 Confidence: 0.18
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
50549 | Complete | Structure prediction | cameo | 2021-01-02_00000090_1_11 | 1571 | 2 Jan 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
49434 | 3 | 1 | 0.18 | comparative modeling | 1522-1571 | 50 | 3 Jan 2021 |
>49434
NVRSSLDRTREQMIATNQLDNRYSVERARTSLDLPGVTNAASLIGTQQNN
>6w2rC_102 weight: 1.0000 score: 24.99 eval: 0.038 prob: n/a identity: 0.1200 startpos: 5
-ERRELEKVARKAIEAAEGNTDEVREQLQRALEIatKTAVKLALDVAL--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington