2021-08-07_00000033_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 107878 | Complete | Structure prediction | RoseTTAFold | 2021-08-07_00000033_1_19 | 98 | 7 Aug 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 104346 | 1 | 1 | 0.82 | RoseTTAFold | 9-98 | 90 | 7 Aug 2021 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: SAALEVLFQGPLAPYEIIVSEDSEHLGKSIGELNVWHQTGATIVAIEHEGKFIVSPGPFSVIEQGDHIFFVGDEDVYARMKTYFNLRMGL
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington