2021-08-14_00000037_2_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
110513 | Complete | Structure prediction | cameo | 2021-08-14_00000037_2_11 | 36 | 14 Aug 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
106781 | 1 | 1 | 0.89 | TrRefineRosetta | 1-36 | 36 | 14 Aug 2021 |
1 . 10 . 20 . 30 .
sequence: YLTERDTKMIMEILDNPPAPNEKLLAAAFALPDMKK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington