2021-08-21_00000105_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
114272 | Complete | Structure prediction | RoseTTAFold | 2021-08-21_00000105_1_19 | 67 | 21 Aug 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
110481 | 1 | 1 | 0.78 | RoseTTAFold | 1-67 | 67 | 21 Aug 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 .
sequence: GPLGMARDIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPDCSGE
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington