2021-08-28_00000239_1_11 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
117504CompleteStructure predictioncameo2021-08-28_00000239_1_1145628 Aug 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
113956110.90TrRefineRosetta19-45643828 Aug 2021
             20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    . 
   sequence: ARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELAARILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGNSELACRILIILFQQLVELARLAIESGDEELLRRVSEWLEEVIKDMRRVVEQALREGN
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington