2021-09-18_00000195_2_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
128518 | Complete | Structure prediction | cameo | 2021-09-18_00000195_2_11 | 30 | 18 Sep 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
124842 | 1 | 1 | 0.79 | TrRefineRosetta | 1-30 | 30 | 18 Sep 2021 |
1 . 10 . 20 . 30
sequence: GFPCGESCVYIPCFTAAIGCSCKSKVCYKN
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington