2021-09-25_00000028_1_11 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
131278CompleteStructure predictioncameo2021-09-25_00000028_1_119225 Sep 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
127589110.89TrRefineRosetta1-929225 Sep 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90  
   sequence: GPMPGLPIKLRVEKAYPEDVGKRAVRMDKASRDRIGVSEGDLVKITGSKTTVARVLPAKKEDVGKGIVRMDKYERQNAGASVGEPVEVDRAE
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington