2021-09-25_00000052_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
131292 | Complete | Structure prediction | RoseTTAFold | 2021-09-25_00000052_1_19 | 49 | 25 Sep 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
127605 | 1 | 1 | 0.77 | RoseTTAFold | 1-49 | 49 | 25 Sep 2021 |
1 . 10 . 20 . 30 . 40 .
sequence: GPMANSSVELRVAEAYPEDVGRGIVRMDKQTRAKLGVSVGDYVEVKKVD
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington