2021-10-02_00000091_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 133815 | Complete | Structure prediction | cameo | 2021-10-02_00000091_1_11 | 135 | 2 Oct 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 130116 | 1 | 1 | 0.78 | TrRefineRosetta | 9-135 | 127 | 2 Oct 2021 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
sequence: PMSDYDIPTTENLYFQGAMSIPRSQTTYKKKEGILTLTEDRKFLIWTPLPATGPPTVSLALDNITNLQQTPPGSAKVILKFTERPRPNAEPGAPPPQYMFQFTHPTDARAEANAIRDLLSQLLAAAR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington