2021-10-02_00000030_1_19 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
133808 | Complete | Structure prediction | RoseTTAFold | 2021-10-02_00000030_1_19 | 122 | 2 Oct 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
130125 | 1 | 1 | 0.76 | RoseTTAFold | 1-122 | 122 | 2 Oct 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120
sequence: SISVSAMESYRSFRVPAINVAQQPAVTLPVTTIVPDSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTDHAIAGLHGMLLGDRRLVVQRSIPGGKNA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington