2021-10-09_00000026_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 137527 | Complete | Structure prediction | RoseTTAFold | 2021-10-09_00000026_1_19 | 148 | 9 Oct 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 133812 | 1 | 1 | 0.88 | RoseTTAFold | 8-148 | 141 | 9 Oct 2021 |
10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 .
sequence: SDILTCTHCQAKNRVGAVPAGQVPSCARCGAALPWLHDGTDATFEQDLQTSVPVLVDFWAPWCGPCRVMGPVLEDLARDLPGKVRVVKVNVDENPRTAARFEVRSIPTLLMFKDGEEVDQMVGVTQKAALRARVEHLNQLS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington