2021-10-09_00000143_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 137551 | Complete | Structure prediction | RoseTTAFold | 2021-10-09_00000143_1_19 | 204 | 9 Oct 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 133865 | 1 | 1 | 0.88 | RoseTTAFold | 13-204 | 192 | 9 Oct 2021 |
. 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200
sequence: SSGHIDDDDKHMMLTKELVKEAREKAIRMLEKACIAITDEEKEKIEVTDFGLGVLYTFGLEILVYVNNERYCAKELVMFPRQICPEHRHPPIGSYLGKQETFRCRWGEVYLYVPGTPTPNPRARIPEEKKRYFTVWHEIVLRPGEQYTIPPNTLHWFQAGDEGAIVSEFSSQSIDEKDIFTDPNVKRIPEIV
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington