2021-10-23_00000171_1_11 Domain 2 Parse 2 Confidence: 0.21

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
142574CompleteStructure predictioncameo2021-10-23_00000171_1_11115423 Oct 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
138915220.21ab initio1091-11546423 Oct 2021
                 . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    
   sequence: DVSEEEDFRLACRHERYPTRHQPHMGDSWPRSSAHEAAELNRQCWVLGHWVGTGGLVPRGSAAA
 deepconcnf: -------EE------------------------HHHHHHH----E-------------------
    psipred: --------EEE---------------------------------EE---EE-------------
    spider3: ---------H---------------------------------------E-----E--------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington