2021-10-23_00000091_1_11 Domain 2 Parse 1 Confidence: 0.28

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
142550CompleteStructure predictioncameo2021-10-23_00000091_1_11106623 Oct 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
139145210.28comparative modeling637-7349824 Oct 2021
              640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    
   sequence: IGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGTVHKGVWIPEGES
 deepconcnf: ----HHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHH--------------------EE-HHHHHH---------EEEEEEEE------
    psipred: ------EEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------------HHH--EE--HHHHH-----------EEE----------
    spider3: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------------------EEEEEHHHHHH----------EEEE-E-------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington