2021-10-23_00000091_1_11 Domain 4 Parse 1 Confidence: 0.06

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
142550CompleteStructure predictioncameo2021-10-23_00000091_1_11106623 Oct 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
139147410.06comparative modeling982-10668524 Oct 2021
                .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 
   sequence: SGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNGGSLEVLFQGPSSPSAWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
 deepconcnf: ----------------------------------EEE-----EEEEEEE------------------------------------
    psipred: -----------------HHHHEE--------------------EEEEEE------------------------------------
    spider3: ---------------------------------EEH-------EEEEEE------------------------------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington