SSGCID - MygeA.20088.a 50S ribosomal protein L28 MG_426 Domain 1 Parse 1 Confidence: 0.64

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
13982CompleteStructure predictionssgcidSSGCID - MygeA.20088.a 50...6415 Jan 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14016110.64comparative modeling1-646416 Jan 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    
   sequence: MAKKDQLTLRGPLYGNNRSHSKTITRRKWNVNLQSCKIKDTNGKVTRILVSTKTIRTLKKQNRF
    psipred: ---EEE---------------------EE---EEEEEEEEE--EEEEEEEEHHH-----EE---
    spider3: ---E-------------E---------EE---EEEEEEE-----EEEEEEEHHEEEEEEEE---
 deepconcnf: ----------------------------------EEEEEE----EEEEEEEHHHHH--------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington