SSGCID - MygeA.17902.a Translation initiation factor IF-1 MG_173 Domain 1 Parse 1 Confidence: 0.97

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
13988CompleteStructure predictionssgcidSSGCID - MygeA.17902.a Tr...7015 Jan 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14203110.97comparative modeling1-707019 Jan 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70
   sequence: MKNDKLFLTGKILEIIHGDKYRVMLENNVEVDAHLAGKMKMKRTKILPGDVVEVEFSPYDLKLGRITQRK
    psipred: ----EEEEEEEEEEE----EEEEEE----EEEEEEE---EEEEEEE----EEEEEE--------EEEE--
    spider3: -----EEEEEEEEEE----EEEEEE----EEEEEEE--E----EEE----EEEEEE---------EEE--
 deepconcnf: -----EEEEEEEEEEE---EEEEEE----EEEEEE-----EEEEEE----EEEEEEEEEE----EEEEE-
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington