SSGCID - MygeA.20184.a 50S ribosomal protein L32 MG_363 Domain 1 Parse 1 Confidence: 0.69

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14024CompleteStructure predictionssgcidSSGCID - MygeA.20184.a 50...5715 Jan 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14438110.69comparative modeling1-575722 Jan 2020
             1   .   10    .   20    .   30    .   40    .   50    .  
   sequence: MAVQQRRSSKHRRDKRRSHDALTLQTLSVCKKCGKKKLSHRVCSCGMYGELRVKKAH
 deepconcnf: ---------------------------EE-----------------EE--EEEEE--
    psipred: -----------------HHH---------------------EE-------EEEEE--
    spider3: ---------------------------EE------EE--EEE-----E--EEEE---
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington