2021-11-13_00000110_1_19 Domain 2 Parse 1 Confidence: 0.86

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
150129CompleteStructure predictionRoseTTAFold2021-11-13_00000110_1_19178413 Nov 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
146531210.86comparative modeling1673-177810614 Nov 2021
               . 1680    . 1690    . 1700    . 1710    . 1720    . 1730    . 1740    . 1750    . 1760    . 1770    .   
   sequence: TLFDRETVRMDDTRLTALGAYDRLTGQWRPRETGLPTLLVSAGEPMGPWPDDSWKPTWPFEHDTVAVPGDHFTMVQEHADAIARHIDAWLGGGNSSSVDKLAAALE
    spider3: -----------HHHHHHHHHHHHHH-----------EEEEE---------------------EEEE----EEEEHHHHHHHHHHHHHHHHH--------HHHHH--
    psipred: -----------HHHHHHHHHHHHHH-----------EEEEEE---------------------EEEE-----HHHHH-HHHHHHHHHHHHH---------------
 deepconcnf: -----------HHHHHHHHHHHHHH-----------EEEEE----------------------EEE-------HHHH-HHHHHHHHHHHH---------HHHHH--
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington