2021-11-13_00000145_1_19 Domain 2 Parse 1 Confidence: 0.91

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
150133CompleteStructure predictionRoseTTAFold2021-11-13_00000145_1_19107613 Nov 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
146562210.91comparative modeling336-107674114 Nov 2021
               340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 
   sequence: KGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA
 deepconcnf: ---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHH-----------------HHHHHHHHHHHHHHHHHH---------------------EEEEEE--------HHH-------------EEEEEEE-------HHHHHHHHH---EEE------HHHHHHHHHH----EEEE--------HHHHHH----HHHHHH-------------EEEE--------------EEEEE---------------------EE------------EE-----HHHHHHH-----EEE--------------------------HHHHHHHHHH---EEEEE------------------------------------------EEEEE--------HHHHHHHHHHHHH----EEEEE------HHHHHHHHHH-------EEEE----HHHHHHH-----EEEE-------HHHHHHHHH---EEE-----HHHHHHHHHHHH---HHHH---HHHHHHHHHHH---HHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHH------EE---------
    psipred: ---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHHH--HHHHHHHHHHHHHH-HHHHHH--------HHHHH----HHHHHHHHHHHHHHHHHHH--------------------EEEEEE--HHHH-HHHHHHHHHHHH-----EEEEEEE-------HHHHHHHHH--EEEE------HHHHHHHHHH----EEEE----------HHHH---HHHHHHH-------------EEEE-------------EEEEEE-----------------------------EEEE---------HHHHHHH----HHHHH---------------EEE---------HHHHHHHH----EE----------------HH----------------HHH-------EEEEE--------HHHHHHHHHHHHH----EEEE----HHHHHHHHHHHHH-------EEE-----HHHHHHHH----EEE-------HHHHHHHHHH---EEE-------HHHHHHHHHH----HHEE--HHHHHHHHHHHH--HHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHH-------EEE--------
    spider3: ---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHH---------HHHH-----HHHHHHHHHHHHHHHHHHHHH------------------EEEEEE-------HHHHHHHHHHH---HHHEEEEEEE-------HHHHHHHHH--EEEE------HHHHHHHHHHH---EEEE--------HHHHHH-----EEEEE--------HHH--EEEE------HHHHHH---EEEE----------HHH---HHH--------------HEEE-----HHHHHHH-----EEEE------------------------HHHHHHHHHHH----EEEE--EE----------------------------HHHH------EEEE----HHH--HHHHHHHHHHHH-----EEEE----HHHHHHHHHHHHH----HHHEEE-----HHHHHHHH----EEE------HHHHHHHHHH----EEE-----HHHHHHHHHHHH---HHHH---HHHHHHHHHHHH--HHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHH-------EE---------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington