2021-12-04_00000028_1_19 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
158342CompleteStructure predictionRoseTTAFold2021-12-04_00000028_1_192254 Dec 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
154471110.76RoseTTAFold11-2252154 Dec 2021
                 .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
   sequence: SSGLEVLFQGPHMFSIRKIITISDYVTMLNIITGLLAILLNSFSLIYLSIIFDSLDGYVARKTGTVSDFGAELDSISDVVSFGVAPAYLLYNNFESNLALISAIIFCLCGALRLARFGILNVKGFIGLPIPAGALLLVGFCQLINSYLINSILAILIGLLMISDIKYPKYPNKIFIYIFAVSLCLAIVGIPHFALMLCLIYAIYGIIKYIRGDLE
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington