2021-12-04_00000033_3_11 Domain 1 Parse 1 Confidence: 0.00

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
158345ErrorStructure predictioncameo2021-12-04_00000033_3_111804 Dec 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
15447611n/aTrRefineRosetta1-1801804 Dec 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
   sequence: GPMGEDQETDFSSTDGAELIAKEPEVYPIDQFMNNTEIWVFNTTQPDPPNCKKDKSKSMTQTATSFVRSHVKNGNIIEENLVGNFTYFNDKEKVYDGIYISGESSGVYAEHLYYVSEDKKCGLFQVFAHVNDKTTIWRDVRVSGRPEEGVPLELNCTKEFDEYVKLVNATSKSPYTSECQ



Baker Lab | Rosetta@home | Contact | Terms of Service
©2022 University of Washington