2021-12-18_00000089_1_11 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 164093 | Complete | Structure prediction | cameo | 2021-12-18_00000089_1_11 | 63 | 18 Dec 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 160180 | 1 | 1 | 0.86 | TrRefineRosetta | 1-63 | 63 | 18 Dec 2021 |
1 . 10 . 20 . 30 . 40 . 50 . 60
sequence: GRRVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington