2021-12-18_00000081_1_11 Domain 2 Parse 1 Confidence: 0.34

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
164091CompleteStructure predictioncameo2021-12-18_00000081_1_11130418 Dec 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
160336210.34comparative modeling879-98210419 Dec 2021
                   .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980  
   sequence: VPGTSTEKTVRSFYYSRNYYVKTGNKPILPSDVEVRYSDGTSDRQNVTWDAVSDDQIAKAGSFSVAGTVAGQKISVRVTMIDEIGALLNYSASTPVGTPAVLPG
    psipred: ---------EEEEE---EEEE----------EEEEEE----EEEEEEEE----HHHH----EEEEEEEE--EEEEEEEEEE-----EEEEEEEEE---------
    spider3: ---------EEEEE---EEEE----------EEEEEE----EEEEE-------HHHH---EEEEEEEEE---EEEEEEEEE----EEE-EEEEE----------
 deepconcnf: -----------EEE---EEEE----------EEEEEE----EEEEEEE------------EEEEEEEEE--EEEEEEEEEEE---EEEEEEEEEE---------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington