2021-12-18_00000081_1_11 Domain 4 Parse 1 Confidence: 0.85

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
164091CompleteStructure predictioncameo2021-12-18_00000081_1_11130418 Dec 2021-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
160338410.85comparative modeling1217-13048819 Dec 2021
             1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    . 1290    . 1300    
   sequence: NTSAALSSLTVNGTKVSDSVLAAGSYNTPAIIADVKAEGEGNASVTVLPAHDNVIRVITESEDHVTRKTFTINLGTEQEFPADSDERD
 deepconcnf: -------EEEE--EE---------EEEE-----EEEEE-----EEEEEE----EEEEEEE------EEEEEEEEEE------------
    psipred: --------EEE--EE---------EEEEE---EEEEEEE----EEEEE-----EEEEEEE-----EEEEEEEEEEE------------
    spider3: -----HHHEEE------------EEEEE-----EEEEE-----EEEEE-----EEEEEEE------EEEEEEEEEE------------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington