T9999s1 Domain 4 Parse 1 Confidence: 0.77

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
116CompleteStructure predictioncaspT9999s128521 Apr 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
164410.77comparative modeling189-2859722 Apr 2018
                   .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
   sequence: VSAGFEHVLEGHFHRPIANNRSVFTISPNELKVILQSNKVVSSPVSMTPDGQYMRTVDVGKVIGTTSIKEGGQPTTTIKVFTDKSGNLITTYPVKGN
 deepconcnf: ---HHHHHHHHH-----------EE--HHHHHHHHH----E----EE-----EEEEEE---EEEEE---------EEEEEEE-----EEEEEE----
    psipred: --HHHHHHHHH-----------EEE--HHHHHHHH----EE-----------EEEEEE---EEEE---------EEEEEEEE-----EEEE------
    spider3: -HHHHHHHHHH----------------HHHHHHHH----------EE-----EEEEEE---EEEEEE------EEEEEEEEE-----EEEE------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington