2022-01-15_00000124_1_19 Domain 2 Parse 1 Confidence: 0.01

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
183316CompleteStructure predictionRoseTTAFold2022-01-15_00000124_1_19130415 Jan 2022-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
180745210.01comparative modeling1162-129813716 Jan 2022
                . 1170    . 1180    . 1190    . 1200    . 1210    . 1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    . 1290    .   
   sequence: VQNPKPRRRDDGDAWHKPPKPATAQSQPDQKPPNKAPSAGSRLPPPQVGEVYEGVVVKVIDTGSLGFLAVEGVAGNIGLHISRLRRIREDAIIVGRRYRFRVEIYVPPKSNTSKLNAADLVRIDENLYFQKLAAALE
    psipred: -------------------------------------------------EEEEEEEEEEEE-----EEEEEEE----EEEHHHHHHHHH--EEEEEEEEEEEEEE-----------HHHEEEE-HHHHHHHHHHH--
    spider3: --------------------------------------------------EE--EEEEEEE-----EEEEE-------EEEEEEEEEEEEEEEE-EEEEEEEEEE------------HHEEE--HHHHHHHHHHH--
 deepconcnf: ------------------------------------------------------EEEEEHH---HHHHHHHHHHHHHHHHHHHHH-----EEEEEEEEEEEEEEE---------------EE--HHHHHHHHHHH--
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington