2022-01-29_00000208_1_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
200276 | Complete | Structure prediction | cameo | 2022-01-29_00000208_1_11 | 34 | 29 Jan 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
196462 | 1 | 1 | 0.91 | TrRefineRosetta | 1-34 | 34 | 29 Jan 2022 |
1 . 10 . 20 . 30
sequence: GDCLGWFSGCDPNNNKCCEGYVCHWKYPWCRYDL
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington