2022-02-05_00000123_3_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
205916 | Complete | Structure prediction | cameo | 2022-02-05_00000123_3_11 | 39 | 5 Feb 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
201874 | 1 | 1 | 0.81 | TrRefineRosetta | 1-39 | 39 | 5 Feb 2022 |
1 . 10 . 20 . 30 .
sequence: SNTYVIKLFDRSVDLAQFSENTPLYPICRAWMRNSPSVR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington