| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 209181 | Complete | Structure prediction | RoseTTAFold | 2022-02-12_00000047_2_19 | 74 | 12 Feb 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 205116 | 1 | 1 | 0.76 | RoseTTAFold | 1-74 | 74 | 12 Feb 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: MLFFKEKFYNELSYYRGGHKDLESMFELALEYIEKLEEEDEQQVTDYENAMEEELRDAVDVIESQLEIIKDIVR
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington