T0953s2 Domain 2 Parse 1 Confidence: 0.41

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
141CompleteStructure predictioncaspT0953s22494 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
212210.41comparative modeling45-1471035 May 2018
                 50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  
   sequence: KEEIWEWTGENHSFNKDWLIGELRNRGGTPVVINIRAHQVSYTPGAPLFEFPGDLPNAYITLNIYADIYGRGGTGGVAYLGGNPGGDCIHNWIGNRLRINNQG
 deepconcnf: --EEEEEE----EEEHHHHH----------EEEEE--EEEE-----------------EEEEEE--EEEE-----------------EEE-----EEEEE---
    psipred: --EEEEEE-----EEHHHHH---------EEEEEEEEEEEE-------EE--------EEEEEE--EEE------------------EEEE---EEEEE----
    spider3: --EEEEEE-----EEHHHHH----------EEEEE--EEEE-------EE--------EEEEEE--EEEE-----------------EEEEE--EEEEEE---
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington