2022-03-05_00000050_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 232208 | Complete | Structure prediction | RoseTTAFold | 2022-03-05_00000050_1_19 | 59 | 5 Mar 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 228080 | 1 | 1 | 0.66 | RoseTTAFold | 1-59 | 59 | 5 Mar 2022 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: GKSSPYQKKTENPCAQRCLQSCQQEPDDLKQKACESRCTKLEYDPRCVYDPRGHTGTTN
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington