T0960 Domain 1 Parse 1 Confidence: 0.02

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
171CompleteStructure predictioncaspT096038411 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
251110.02comparative modeling1-676711 May 2018
             1   .   10    .   20    .   30    .   40    .   50    .   60    .  
   sequence: SGSEFVTAGMALAATDIPGLDASKLVSGVLAEQRLPVFARGLATAVSNSSDPNTATVPLMLTNHANG
 deepconcnf: -----EEE----------------EEE----------------------------------------
    psipred: ----EEE--------------HHHH-------------HHHHH---------EEEEHHHHHH-----
    spider3: -----E-------HHH-----HHHHH----HHHH--HHH--HH-----------EEE-EEE------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington