T0960 Domain 2 Parse 1 Confidence: 0.06

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
171CompleteStructure predictioncaspT096038411 May 2018-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
252210.06comparative modeling63-1327011 May 2018
               .   70    .   80    .   90    .  100    .  110    .  120    .  130  
   sequence: NHANGPVAGRYFYIQSMFYPDQNGNASQIATSYNATSEMYVRVSYAANPSIREWLPWQRCDIGGSFTKTT
 deepconcnf: -----------EEEEEEE-------EEEEEEEE-----EEEEEEE------------EEE----------
    psipred: -----------EEEEEEEE------EEEEEEEE-----EEEEEEE------------EEEEE--------
    spider3: -----------EEEEEEEE------EEEEEEEE-----EEEEEEE-----------EEEEEE--------
| | View
Powered by 3Dmol.js
| | Alignment


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington