| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|---|---|---|---|---|---|---|
| 264480 | Complete | Structure prediction | RoseTTAFold | 2022-03-26_00000059_1_19 | 72 | 26 Mar 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|---|---|---|---|---|---|---|
| 260267 | 1 | 1 | 0.80 | RoseTTAFold | 1-72 | 72 | 26 Mar 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70
sequence: GPHMDYDMLTEEQKKKLKEDHTLKILLKNNYVREVFKQFTLSNDKIGYLSHYINDPTIVQVIDHIMKTIDDT
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington