2022-04-02_00000009_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 268743 | Complete | Structure prediction | RoseTTAFold | 2022-04-02_00000009_2_19 | 59 | 2 Apr 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 264526 | 1 | 1 | 0.84 | RoseTTAFold | 1-59 | 59 | 2 Apr 2022 |
1 . 10 . 20 . 30 . 40 . 50 .
sequence: AMDPPHRPRPGAFRGGERVVHPRFGPGTVVAAQGDEVTVHFEGFGLKRLSLKYAELKPA
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington