2022-04-09_00000151_1_19 Domain 1 Parse 1 Confidence: 0.06

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
272893CompleteStructure predictionRoseTTAFold2022-04-09_00000151_1_1911729 Apr 2022-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
268970110.06comparative modeling1-999910 Apr 2022
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .    
   sequence: MVSGVGGSGGGRGGGRGGEEEPSSSHTPNNRRGGEQAQSSGTKSLRPRSNTESMSKAIQQYTVDARLHAVFEQSGESGKSFDYSQSLKTTTYGSSVPEQ
 deepconcnf: --------------------------------------------------HHHHHHHHHHHHHHHHHHHHHHHH-------------------------
    psipred: ---------------------------------HHHH-------------HHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHH----------
    spider3: -----------------------------------E---------------------EEEEEEEEEEEEEEEE-------EE-----------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington