2022-04-16_00000082_2_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 279059 | Complete | Structure prediction | RoseTTAFold | 2022-04-16_00000082_2_19 | 81 | 16 Apr 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 277397 | 1 | 1 | 0.73 | RoseTTAFold | 11-81 | 71 | 19 Apr 2022 |
. 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: SENLYFQSGGGRDEIKERIFKAVVRAIVTGNPEQLKEAKKLLEKLKKLGRLDQDAKKFEKAIRQVEKRLRS
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington