2022-04-30_00000102_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 292132 | Complete | Structure prediction | RoseTTAFold | 2022-04-30_00000102_1_19 | 35 | 30 Apr 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 287840 | 1 | 1 | 0.84 | RoseTTAFold | 1-35 | 35 | 30 Apr 2022 |
1 . 10 . 20 . 30 .
sequence: AFRQALQLAASGLAGGSAAVLFSAVAVGKPRAGGD
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington