T1061 Domain 2 Parse 1 Confidence: 0.07

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
29815CompleteStructure predictioncaspT106194919 Jun 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
29308210.07comparative modeling184-2436020 Jun 2020
              .  190    .  200    .  210    .  220    .  230    .  240   
   sequence: VNGTLQPSNGAKRPEYQEDYGFFHSNKSTTILAKYQVKEERYKLQSKKKLFGLSRSYSLK
 deepconcnf: ---EE-------------------HHHHHHHHHHHHHHH--EE------EE---EEEEE-
    psipred: ---EE--------HHH------EE--HHHHHHHHHHHHHHHHHHHH--------------
    spider3: ---EE--HHH---HHH-----EEE---EEEEEEEEEEEEEEEEE----------------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington