T1061 Domain 7 Parse 1 Confidence: 0.11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
29815CompleteStructure predictioncaspT106194919 Jun 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
29313710.11comparative modeling667-7569020 Jun 2020
              670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    . 
   sequence: KFIGIEPNDPIAFTYERYGWKDKFFLVDEVENTRDGKINLVLQEYGEDVFINSEQVDNSGNDIPDISNNVLPPRDFKYTPTPGGVVGAIG
 deepconcnf: ----------EEEEE-------EEEEEEEEEE----EEEEEEEEE---EEEE------------------------EE------------
    psipred: ----EE----EEEEEE-------EEEEEEEEE----EEEEEEEE----EEE--HH-----------EE--------EE------------
    spider3: EEEEEE----EEEEHHH-----EEEEEEEEEEEE--EEEEEEEEE----EE------------------------EEEE-----------
| | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Alignment cluster 2 [ RosettaCM constraints ]

Alignment cluster 3 [ RosettaCM constraints ]

Alignment cluster 4 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington