T1066s2 Domain 1 Parse 2 Confidence: 0.27

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
30488CompleteStructure predictioncaspT1066s212324 Jun 2020-
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
29858120.27ab initio1-12312324 Jun 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120   
   sequence: MNNDRGQSLHIPSSTPIKENNIYVATLHSVIQTDFSGEIKHQFTYEIEVNNQIVYANRNIPTKPSANQLSIHDWLKRHSNYSASHENYEPYIDQKHLILLGQYNGNYYVQDVASLDAFGGVLS
    psipred: -------EEE-----------EEEEEEEEEEE-------EEEEEEEEEE--EEEEEE----------EE-HHHHHHH-------------------EEEEEEE---EEEEEE--HHH------
    spider3: ---------------------EEEEEEEEEEEE-----EEEEEEEEEEE--EEEEEEE----------EEHHHHHHH------------------EEEEEEEE--EEEEEEE-----------
 deepconcnf: -------EEE-----------EEEEEEEEEEE------EEEEEEEEEEE--EEEEEEEE-----------HHHHHHH-------------------EEEEEEE--EEEEEEEEE---------
| | View
Powered by 3Dmol.js




Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington