2022-05-14_00000050_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 305067 | Complete | Structure prediction | RoseTTAFold | 2022-05-14_00000050_1_19 | 95 | 14 May 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 301844 | 1 | 1 | 0.79 | RoseTTAFold | 1-95 | 95 | 16 May 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 .
sequence: SAGIATFKLVLNGKTLKGETTTEAVDAATALKNFGAYAQDVGVDGAWTYDDATKTFTVGERLIFKVKMPEDRMNDLARQLRQRDNVSRVEVTRYK
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington