2022-05-21_00000150_1_19 Domain 1 Parse 1 Confidence: 0.00
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 310236 | Complete | Structure prediction | RoseTTAFold | 2022-05-21_00000150_1_19 | 195 | 21 May 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 305849 | 1 | 1 | 0.88 | RoseTTAFold | 1-195 | 195 | 21 May 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 .
sequence: MTPSDIPGYDYGRVEKSPITDLEFDLLKKTVMLGEKDVMYLKKAGDVLKDQVDEILDLLVGWRASNEHLIYYFSNPDTGEPIKEYLERVRARFGAWILDTTSRDYNREWLDYQYEVGLRHHRSKKGVTDGVRTVPHIPLRYLIAQIYPLTATIKPFLAKKGGSPEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington