2022-06-04_00000141_1_11 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
322975 | Error | Structure prediction | cameo | 2022-06-04_00000141_1_11 | 116 | 4 Jun 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
318650 | 1 | 1 | n/a | TrRefineRosetta | 1-116 | 116 | 4 Jun 2022 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 .
sequence: VLEEDREPDFIEVTSLQEFKDIMSMDILTVACFWADDCGPCKLIEEPLKKIAEDFPDVVFALVDADKNPEIIKELNVKSLPTWIIARSGEYLGDVVGAKPDLLIEKIKNIKKNLEH
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington